PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G150600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 352aa    MW: 39723.8 Da    PI: 6.7756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G150600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171462148
                       TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W++eEd +l+++++q+G+g +W + ++++g++R++k+c++rw++yl
  Aqcoe7G150600.1.p 14 KGPWSPEEDAKLKEYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                       79*********************************************97 PP

2Myb_DNA-binding36.41.2e-1169111246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g +++eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
  Aqcoe7G150600.1.p  69 GGFSEEEDHMICSLYMSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                        569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.202966IPR017930Myb domain
SuperFamilySSF466892.01E-2711109IPR009057Homeodomain-like
SMARTSM007171.2E-131364IPR001005SANT/Myb domain
PfamPF002492.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-251569IPR009057Homeodomain-like
CDDcd001672.47E-101662No hitNo description
SMARTSM007179.3E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.40167117IPR017930Myb domain
PfamPF002491.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKEYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNLKHGG FSEEEDHMIC SLYMSIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
QRKEHQARRA SYLKQDSMKK SNSIPLVIAD HGMQTPYWPP EPLMPISTPY PNQGNRHNDH  180
ASLRKLLIKL GGKFSDDYQQ EPNNDAKNNL QLPIECSSTT YQQFNDQKSI NLFSSSSSMS  240
SLDIPYSKLL TNEYNIEGAS MHVLQGLNGF PVEFDEMICS NPESLDELEC HYGVGMDNGV  300
SSSGPISTES TTWDDMGSFI NPPNITNYEA LQQEVIQECA LFDQSRYLGF Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010664473.11e-143PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y94e-82RAX3_ARATH; Transcription factor RAX3
TrEMBLE0CNX01e-143E0CNX0_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08470.t011e-142(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.13e-77myb domain protein 84